Structure of PDB 7mdz Chain F

Receptor sequence

>7mdzF (length=225) Species: 9986 (Oryctolagus cuniculus)

NFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMAR
MARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFV
KLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNT
LIARSLGKYNIICMEDLIHEIYTVGKHFKEANNFLWPFKLSSPRGGMKKK
TTHFVEGGDAGNREDQINRLIRRMN

3D structure

• PDB: 7mdz Discovery of C13-Aminobenzoyl Cycloheximide Derivatives that Potently Inhibit Translation Elongation.
• Chain: F
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	N23 F24 A25 K28 K30 R31 L32 R33 K34 F36 A37 R42 R45 K47 Y50 H57 Y60 Q62 Y64 R65 I68 R69 M70 R72 M73 R75 R95 G96 I97 N98 G99 P102 K103 K106 V107 L110 R112 Q115 I116 K123 K126 A127 N130 M131 N145 L146 K147 N150 K155 R156 K164 R165 T172 A175 R176 G179 I184 E187 K201 N205 K211 L212 S213 S214 P215 R216 G217 G218 M219 K221 K222 R241	N1 F2 A3 K6 K8 R9 L10 R11 K12 F14 A15 R20 R23 K25 Y28 H35 Y38 Q40 Y42 R43 I46 R47 M48 R50 M51 R53 R73 G74 I75 N76 G77 P80 K81 K84 V85 L88 R90 Q93 I94 K101 K104 A105 N108 M109 N123 L124 K125 N128 K133 R134 K142 R143 T150 A153 R154 G157 I162 E165 K179 N183 K189 L190 S191 S192 P193 R194 G195 G196 M197 K199 K200 R219
BS02	rna	F	R133 E136 T223 H225 E228	R111 E114 T201 H203 E206

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005737 cytoplasm
• GO:0022625 cytosolic large ribosomal subunit

External links

• PDB: RCSB:7mdz, PDBe:7mdz, PDBj:7mdz
• PDBsum: 7mdz
• PubMed: 34403584
• UniProt: G1TUB1