Structure of PDB 7m54 Chain F |
>7m54F (length=150) Species: 12881 (Satellite tobacco mosaic virus) [Search protein sequence] |
RKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGS LFSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEF EGRASNINTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN |
|
PDB | 7m54 Structures of additional crystal forms of Satellite tobacco mosaic virus grown from a variety of salts. |
Chain | F |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
F |
T82 S92 R119 A120 |
T73 S83 R110 A111 |
|
|
|
|