Structure of PDB 7kin Chain F

Receptor sequence

>7kinF (length=317) Species: 1773 (Mycobacterium tuberculosis)

ALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYAT
QLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRY
TGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMA
DQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKV
LEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQL
QSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKT
MSKLRHPSRSQVLRDYL

3D structure

• PDB: 7kin Structural basis of transcriptional activation by the Mycobacterium tuberculosis intrinsic antibiotic-resistance transcription factor WhiB7.
• Chain: F
• Resolution: 2.74 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	R229 L232 L240 R301 L302 R330 D336 Y341 K342 S344 T345 Y346 W349 W350 Q353 R357 R367 H371 V498 T499	R19 L22 L30 R91 L92 R120 D126 Y131 K132 S134 T135 Y136 W139 W140 Q143 R147 R157 H161 V288 T289
BS02	dna	F	R309 R313 R352 R381 L489 R500 R504	R99 R103 R142 R171 L279 R290 R294

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0009415 response to water
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:7kin, PDBe:7kin, PDBj:7kin
• PDBsum: 7kin
• PubMed: 34171296
• UniProt: P9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)