Structure of PDB 7ins Chain F

Receptor sequence

>7insF (length=30) Species: 9823 (Sus scrofa)

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

3D structure

• PDB: 7ins Structure of porcine insulin cocrystallized with clupeine Z.
• Chain: F
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	F	F1 V2	F1 V2
BS02	peptide	F	C7 L11 V18 C19 R22 G23 Y26 K29	C7 L11 V18 C19 R22 G23 Y26 K29
BS03	peptide	F	N3 L6 H10 E13 A14 P28 K29	N3 L6 H10 E13 A14 P28 K29

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:7ins, PDBe:7ins, PDBj:7ins
• PDBsum: 7ins
• PubMed: 1772633
• UniProt: P01315|INS_PIG Insulin (Gene Name=INS)