Structure of PDB 7fj2 Chain F

Receptor sequence
>7fj2F (length=80) Species: 9606 (Homo sapiens) [Search protein sequence]
SVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGW
KNSIRHNLSLHDMFVRETSANGKVSFWTIH
3D structure
PDB7fj2 Mechanistic Insights into the Preference for Tandem Binding Sites in DNA Recognition by FOXM1.
ChainF
Resolution3.098 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F L259 K260 R286 H287 S290 S306 W308 L28 K29 R55 H56 S59 S75 W77
BS02 dna F R236 S240 Y241 N283 S284 H287 R5 S9 Y10 N52 S53 H56
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0000086 G2/M transition of mitotic cell cycle
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7fj2, PDBe:7fj2, PDBj:7fj2
PDBsum7fj2
PubMed34973238
UniProtQ08050|FOXM1_HUMAN Forkhead box protein M1 (Gene Name=FOXM1)

[Back to BioLiP]