Structure of PDB 7f0r Chain F

Receptor sequence
>7f0rF (length=278) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
TRALDATQLYLNEIGFSPLLTPEEEVHFARLAQKGDPAGRKRMIESNLRL
VVKIARRYVNRGLSLLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIR
QTIERAIMNQTRTIRLPIHVVKELNVYLRAARELTHKLDHEPSPEEIANL
LEKPVAEVKRMLGLNERVTSVDVSLGPDSDKTLLDTLTDDRPTDPCELLQ
DDDLSESIDQWLTELTDKQREVVIRRFGLRGHESSTLEEVGQEIGLTRER
VRQIQVEALKRLREILEKNGLSSDALFQ
3D structure
PDB7f0r Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
ChainF
Resolution5.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F W153 R156 E160 T292 E305 R308 W97 R100 E104 T236 E249 R252
BS02 dna F D140 R146 T149 Y150 W154 Q157 R171 P173 I174 H175 D84 R90 T93 Y94 W98 Q101 R115 P117 I118 H119
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:0050921 positive regulation of chemotaxis
GO:1900034 regulation of cellular response to heat
GO:1900233 positive regulation of single-species biofilm formation on inanimate substrate
GO:1900377 negative regulation of secondary metabolite biosynthetic process
GO:1900407 regulation of cellular response to oxidative stress
GO:1901000 regulation of response to salt stress
GO:2000142 regulation of DNA-templated transcription initiation
GO:2000145 regulation of cell motility
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f0r, PDBe:7f0r, PDBj:7f0r
PDBsum7f0r
PubMed35859063
UniProtP45684|RPOS_PSEAE RNA polymerase sigma factor RpoS (Gene Name=rpoS)

[Back to BioLiP]