Structure of PDB 7e9f Chain F

Receptor sequence
>7e9fF (length=81) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSV
TYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
3D structure
PDB7e9f Nucleosome binding relinquishes the association of the BAH domain of Orc1 with Sir1
ChainF
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F T30 P32 R36 T10 P12 R16
BS02 dna F R35 R45 I46 S47 G48 R78 K79 T80 R15 R25 I26 S27 G28 R58 K59 T60
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0042802 identical protein binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006355 regulation of DNA-templated transcription
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0045943 positive regulation of transcription by RNA polymerase I
Cellular Component
GO:0000500 RNA polymerase I upstream activating factor complex
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e9f, PDBe:7e9f, PDBj:7e9f
PDBsum7e9f
PubMed
UniProtP02309|H4_YEAST Histone H4 (Gene Name=HHF1)

[Back to BioLiP]