Structure of PDB 7d6r Chain F |
>7d6rF (length=70) Species: 562 (Escherichia coli) [Search protein sequence] |
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVT IKSSTCESGSGFAEVQFNND |
|
PDB | 7d6r Identification of a peptide motif that potently inhibits two functionally distinct subunits of Shiga toxin. |
Chain | F |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
1PS |
F |
N14 D16 T18 W29 |
N14 D16 T18 W29 |
|
|
|
|