Structure of PDB 7crr Chain F |
>7crrF (length=86) Species: 8355 (Xenopus laevis) [Search protein sequence] |
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVI RDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
|
PDB | 7crr Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases. |
Chain | F |
Resolution | 3.48 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
F |
R45 I46 G48 T80 |
R29 I30 G32 T64 |
|
|
|
|