Structure of PDB 7blz Chain F

Receptor sequence

>7blzF (length=155) Species: 280699 (Cyanidioschyzon merolae strain 10D) [Search protein sequence]

VLTPCQQSEAFHKREINEVRTLENRQANYEANSPSYLALQSQIDQVHKRF
DKYGTLLCGQDGLPHLITDGDWRHAREFTIPALLFLYITGWIGWVGRSYL
KYTKETKNPTEQEIILDVPMALKYMLSGFLWPLSAWQEYRSGQLLAKEDE
ITVSP

3D structure

PDB

7blz Red alga C.merolae Photosystem I

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	F	L155 F158	L126 F129
BS02	CLA	F	G122 G125 Y128	G93 G96 Y99
BS03	CLA	F	T97 F107 A111 L112	T68 F78 A82 L83
BS04	CLA	F	Y128 L129 E142 L151 M154	Y99 L100 E113 L122 M125
BS05	CLA	F	A111 F114 L115 T118	A82 F85 L86 T89
BS06	CLA	F	Y116 I117 W120 I121 V124 M154 F158 L159 P161	Y87 I88 W91 I92 V95 M125 F129 L130 P132
BS07	CLA	F	D98 G99 D100 W101 T108	D69 G70 D71 W72 T79

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7blz, PDBe:7blz, PDBj:7blz
PDBsum	7blz
PubMed
UniProt	Q85FS9

[Back to BioLiP]