Structure of PDB 7aqc Chain F

Receptor sequence

>7aqcF (length=178) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

NRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAID
SAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLD
KLISVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRG
MDIVIVTTANTDEEARELLTQVGMPFQK

3D structure

• PDB: 7aqc Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
• Chain: F
• Resolution: 2.99 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	K33 N37 G39 T68 A70 K72 I74 G76 F77 L79 K88 S121 D123 R125 N127 T129 I132 K133 G151 M152 D153	K32 N36 G38 T67 A69 K71 I73 G75 F76 L78 K87 S120 D122 R124 N126 T128 I131 K132 G150 M151 D152
BS02	rna	F	K5 S24 M26 K30 Q63 K64 V66 T90 R92	K4 S23 M25 K29 Q62 K63 V65 T89 R91
BS03	rna	F	S73 R78 R80	S72 R77 R79

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7aqc, PDBe:7aqc, PDBj:7aqc
• PDBsum: 7aqc
• PubMed: 33259811
• UniProt: P12877|RL5_BACSU Large ribosomal subunit protein uL5 (Gene Name=rplE)