Structure of PDB 6zmw Chain F

Receptor sequence
>6zmwF (length=47) Species: 9606 (Homo sapiens) [Search protein sequence]
LARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVKGPNANS
3D structure
PDB6zmw Structure of a human 48Stranslational initiation complex.
ChainF
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F R82 A83 G84 K85 V86 R87 Q89 T90 V93 K95 K98 K100 T103 R105 K107 R108 R109 N113 R115 P129 N130 A131 N132 S133 R3 A4 G5 K6 V7 R8 Q10 T11 V14 K16 K19 K21 T24 R26 K28 R29 R30 N34 R36 P43 N44 A45 N46 S47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zmw, PDBe:6zmw, PDBj:6zmw
PDBsum6zmw
PubMed32883864
UniProtP62861|RS30_HUMAN Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein (Gene Name=FAU)

[Back to BioLiP]