Structure of PDB 6z5s Chain F

Receptor sequence
>6z5sF (length=48) Species: 258594 (Rhodopseudomonas palustris CGA009) [Search protein sequence]
SISGLSEAEAKEFHSIFVTSFFLFIVVAVVAHILAWMWRPWLPKATGY
3D structure
PDB6z5s Structures of Rhodopseudomonas palustris RC-LH1 complexes with open or closed quinone channels.
ChainF
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL F L38 A39 L34 A35
BS02 BCL F F28 A35 H36 F24 A31 H32
BS03 BCL F F28 I29 A32 H36 W45 F24 I25 A28 H32 W41
BS04 CRT F E16 F17 I20 F21 S24 F25 E12 F13 I16 F17 S20 F21
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6z5s, PDBe:6z5s, PDBj:6z5s
PDBsum6z5s
PubMed33523887
UniProtQ6N9L5

[Back to BioLiP]