Structure of PDB 6wu9 Chain F

Receptor sequence

>6wu9F (length=177) Species: 474186 (Enterococcus faecalis OG1RF)

NRLKEKYIKEVTPSLVEKFNYSSVMQTPKVDKIVINMGVGDAVSNAKNLD
KAVEELALITGQKPLITKAKKSIAGFRLREGMPIGAKVTLRGERMYEFLD
KLVTVSLPRVRDFHGVSKKAFDGRGNYTLGIKEQLIFPEVDYDLVDKVRG
MDIVIVTTANTDEESRELLAQLGMPFQ

3D structure

• PDB: 6wu9 Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
• Chain: F
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	K33 N37 G39 V40 G41 V44 T68 K69 A70 K72 F77 L79 I85 K120 A121 D123 R125 T129 L130 I132 K133 G151 M152 D153	K32 N36 G38 V39 G40 V43 T67 K68 A69 K71 F76 L78 I84 K119 A120 D122 R124 T128 L129 I131 K132 G150 M151 D152
BS02	rna	F	M26 Q27 Q63 K64 L66 T90 R92	M25 Q26 Q62 K63 L65 T89 R91

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6wu9, PDBe:6wu9, PDBj:6wu9
• PDBsum: 6wu9
• PubMed: 33004869
• UniProt: Q839F2|RL5_ENTFA Large ribosomal subunit protein uL5 (Gene Name=rplE)