Structure of PDB 6wj6 Chain F

Receptor sequence

>6wj6F (length=32) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa)

PIFTVRWLAVHTLAVPSVFFVGAIAAMQFIQR

3D structure

• PDB: 6wj6 Cryo-EM Structure of Monomeric Photosystem II from Synechocystis sp. PCC 6803 Lacking the Water-Oxidation Complex
• Chain: F
• Resolution: 2.58 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	F	R18 W19 V22 H23 A26	R6 W7 V10 H11 A14

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030096 plasma membrane-derived thylakoid photosystem II
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:6wj6, PDBe:6wj6, PDBj:6wj6
• PDBsum: 6wj6
• UniProt: P09191|PSBF_SYNY3 Cytochrome b559 subunit beta (Gene Name=psbF)