Structure of PDB 6vz4 Chain F

Receptor sequence
>6vz4F (length=79) Species: 8355 (Xenopus laevis) [Search protein sequence]
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT
EHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB6vz4 Structural insights into assembly and function of the RSC chromatin remodeling complex.
ChainF
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F P33 R37 R46 P9 R13 R22
BS02 dna F R46 I47 S48 G49 R79 K80 R22 I23 S24 G25 R55 K56
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vz4, PDBe:6vz4, PDBj:6vz4
PDBsum6vz4
PubMed33288924
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]