Structure of PDB 6vvt Chain F

Receptor sequence

>6vvtF (length=303) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

ADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYATQKLAELAEKGEKLP
VQQRRDMQWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDLIQEG
NLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVE
VINKLGRIQRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLD
QTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLETLSEREAGV
VRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLR
DYL

3D structure

• PDB: 6vvt The antibiotic sorangicin A inhibits promoter DNA unwinding in a Mycobacterium tuberculosis rifampicin-resistant RNA polymerase.
• Chain: F
• Resolution: 2.901 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	L178 N237 R239 L240 R268 K272 F273 D274 K277 Y279 K280 S282 T283 Y284 T286 W287 W288 Q291 R295 R305 P307 H309 T437 R440 Q443	L16 N75 R77 L78 R106 K110 F111 D112 K115 Y117 K118 S120 T121 Y122 T124 W125 W126 Q129 R133 R143 P145 H147 T275 R278 Q281
BS02	dna	F	R290 E312 R319 R416 T426 L427 R438 E439 R442	R128 E150 R157 R254 T264 L265 R276 E277 R280

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6vvt, PDBe:6vvt, PDBj:6vvt
• PDBsum: 6vvt
• PubMed: 33199626
• UniProt: A0QW02