Structure of PDB 6vvs Chain F

Receptor sequence

>6vvsF (length=305) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

SADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYATQKLAELAEKGEKL
PVQQRRDMQWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDLIQE
GNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMV
EVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISL
DQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLETLSEREAG
VVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVL
RDYLD

3D structure

• PDB: 6vvs The antibiotic sorangicin A inhibits promoter DNA unwinding in a Mycobacterium tuberculosis rifampicin-resistant RNA polymerase.
• Chain: F
• Resolution: 3.112 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	L178 N237 R239 L240 R268 K272 F273 D274 K277 Y279 K280 S282 T283 Y284 T286 W287 W288 Q291 R295 R305 P307 V308 H309 R408 T437 R440 Q443	L17 N76 R78 L79 R107 K111 F112 D113 K116 Y118 K119 S121 T122 Y123 T125 W126 W127 Q130 R134 R144 P146 V147 H148 R247 T276 R279 Q282
BS02	dna	F	E312 R319 R416 T426 L427 R438 E439 R442	E151 R158 R255 T265 L266 R277 E278 R281

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6vvs, PDBe:6vvs, PDBj:6vvs
• PDBsum: 6vvs
• PubMed: 33199626
• UniProt: A0QW02