Structure of PDB 6vmi Chain F

Receptor sequence

>6vmiF (length=250) Species: 9606 (Homo sapiens)

EPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLD
ILHQVAMWQKNFKRISYAKTKTRAEVRGGGRKPWPQKGTGRARHGSIRSP
LWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLAQDDLHIMDSLE
LPTGDPQYLTELAHYRRWGDSVLLVDLTHEEMPQSIVEATSRLKTFNLIP
AVGLNVHSMLKHQTLVLTLPTVAFLEDKLLWQDSRYRPLYPFSLPYSDFP

3D structure

• PDB: 6vmi Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
• Chain: F
• Resolution: 2.96 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	R92 H97 M101 K104 R108 Y111 T114 K115 T116 R117 A118 R121 G124 R125 Q130 K131 G134 R135 A136 R137 H138 G139 R142 L145 W146 R147 G148 V151 H153 P155 K168 V169 K255 R281 P282 L283 P285	R48 H53 M57 K60 R64 Y67 T70 K71 T72 R73 A74 R77 G80 R81 Q86 K87 G90 R91 A92 R93 H94 G95 R98 L101 W102 R103 G104 V107 H109 P111 K124 V125 K211 R237 P238 L239 P241
BS02	MG	F	G148 G149	G104 G105

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6vmi, PDBe:6vmi, PDBj:6vmi
• PDBsum: 6vmi
• PubMed: 32737313
• UniProt: Q9BYD3|RM04_HUMAN Large ribosomal subunit protein uL4m (Gene Name=MRPL4)