Structure of PDB 6v92 Chain F

Receptor sequence
>6v92F (length=67) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
GEILWFRGPSVIVNERIINSGDPHLSLPLNRWFTLEPDVENEKESLPGPF
VLGLRPSAKFTAHRLSM
3D structure
PDB6v92 Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
ChainF
Resolution20.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F E788 I789 L790 W791 F792 R793 E2 I3 L4 W5 F6 R7
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006276 plasmid maintenance
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006325 chromatin organization
GO:0006337 nucleosome disassembly
GO:0006338 chromatin remodeling
GO:0006366 transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0007059 chromosome segregation
GO:0007062 sister chromatid cohesion
GO:0030435 sporulation resulting in formation of a cellular spore
GO:0042173 regulation of sporulation resulting in formation of a cellular spore
GO:0070914 UV-damage excision repair
Cellular Component
GO:0005634 nucleus
GO:0016586 RSC-type complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v92, PDBe:6v92, PDBj:6v92
PDBsum6v92
PubMed31886770
UniProtQ06488|RSC2_YEAST Chromatin structure-remodeling complex subunit RSC2 (Gene Name=RSC2)

[Back to BioLiP]