Structure of PDB 6uzv Chain F

Receptor sequence
>6uzvF (length=141) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]
DFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPH
LIVDGRFTHAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQEVV
INVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR
3D structure
PDB6uzv The structure of a red-shifted photosystem I reveals a red site in the core antenna.
ChainF
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA F G80 G83 Y86 G78 G81 Y84
BS02 CLA F V132 D135 V130 D133
BS03 CLA F F65 S69 F72 A76 W118 F63 S67 F70 A74 W116
BS04 CLA F V55 S69 V53 S67
BS05 CLA F L87 E100 I103 L85 E98 I101
BS06 CLA F W78 I79 M112 W76 I77 M110
BS07 CLA F D56 R58 D54 R56
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uzv, PDBe:6uzv, PDBj:6uzv
PDBsum6uzv
PubMed33077842
UniProtP29256|PSAF_SYNY3 Photosystem I reaction center subunit III (Gene Name=psaF)

[Back to BioLiP]