Structure of PDB 6ulg Chain F

Receptor sequence
>6ulgF (length=273) Species: 9606 (Homo sapiens) [Search protein sequence]
KKKVLLMGKSGSGKNSMRSIIFAVRFLGNLVLNLWDCGGQDTFMENYFTS
QRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLV
HKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSI
VYQLIPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVH
RFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVM
SDPSIPSAATLINIRNARKHFEK
3D structure
PDB6ulg Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
ChainF
Resolution3.31 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP F S16 G19 K20 N21 S22 H127 K128 D130 I164 S10 G13 K14 N15 S16 H101 K102 D104 I138
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0031625 ubiquitin protein ligase binding
GO:0042803 protein homodimerization activity
GO:0043495 protein-membrane adaptor activity
GO:0046982 protein heterodimerization activity
GO:0051219 phosphoprotein binding
Biological Process
GO:0006915 apoptotic process
GO:0008104 protein localization
GO:0009267 cellular response to starvation
GO:0010507 negative regulation of autophagy
GO:0031669 cellular response to nutrient levels
GO:0032008 positive regulation of TOR signaling
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0034198 cellular response to amino acid starvation
GO:0035556 intracellular signal transduction
GO:0042593 glucose homeostasis
GO:0061462 protein localization to lysosome
GO:0071230 cellular response to amino acid stimulus
GO:0072657 protein localization to membrane
GO:1904263 positive regulation of TORC1 signaling
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:1990130 GATOR1 complex
GO:1990131 Gtr1-Gtr2 GTPase complex
GO:1990877 FNIP-folliculin RagC/D GAP

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ulg, PDBe:6ulg, PDBj:6ulg
PDBsum6ulg
PubMed31704029
UniProtQ7L523|RRAGA_HUMAN Ras-related GTP-binding protein A (Gene Name=RRAGA)

[Back to BioLiP]