Structure of PDB 6uca Chain F

Receptor sequence

>6ucaF (length=398) Species: 9606 (Homo sapiens)

VLPLDAPLCPHGPTLLFVTRRFYACSACRDRKDCNFFQWEDEKLSGARLA
AREAHNRRCQPPLSRTQCVERYLKFIELPLTQRKFCQTCQQLLLPDDWGQ
HSEHQVLGNVSITQLRRPSQLLYPLENAATNAQYLFADRSCQFLVDLLSA
LGFRRVLCVGTPRLHELIKLTASGDKKSNIKSLLLDIDFRYSQFYMEDSF
CHYNMFNHHFFDGKTALEVCRAFLQEDKGEGIIMVTDPPFGGLVEPLAIT
FKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFQMLDYQVD
YDNHALYKHGKRKQSPVRIFTNIPPNKIILPTEEGYRFCSPCQRYVSLEN
QHCELCNSCTSKDGRKWNHCFLCKKCVKPSWIHCSICNHCAVPDHSCE

3D structure

• PDB: 6uca Structure and regulation of ZCCHC4 in m6A-methylation of 28S rRNA.
• Chain: F
• Resolution: 3.103 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAH	F	N170 Q172 Y173 L174 F175 G199 T200 P201 R202 D225 I226 N243 M244 F245 D276 P278	N131 Q133 Y134 L135 F136 G160 T161 P162 R163 D186 I187 N204 M205 F206 D237 P239
BS02	ZN	F	C40 H42 C64 C73	C9 H11 C25 C34
BS03	ZN	F	C128 H140 H143	C89 H101 H104
BS04	ZN	F	C380 H393 C400	C339 H352 C359
BS05	ZN	F	C394 H410 C417	C353 H369 C376
BS06	ZN	F	C411 C414 H424 C431	C370 C373 H383 C390
BS07	ZN	F	C425 C428 H436 C438	C384 C387 H395 C397

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008168 methyltransferase activity
• GO:0008270 zinc ion binding
• GO:0008988 rRNA (adenine-N6-)-methyltransferase activity

Biological Process

• GO:0031167 rRNA methylation
• GO:0032259 methylation

External links

• PDB: RCSB:6uca, PDBe:6uca, PDBj:6uca
• PDBsum: 6uca
• PubMed: 31695039
• UniProt: Q9H5U6|ZCHC4_HUMAN rRNA N6-adenosine-methyltransferase ZCCHC4 (Gene Name=ZCCHC4)