Structure of PDB 6uaj Chain F

Receptor sequence

>6uajF (length=489) Species: 9606 (Homo sapiens)

TSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKI
TLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKK
YEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIIS
SRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKL
PIVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYR
LDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQ
AKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGV
PVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLK
KYRGMGSLDAMIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKS
LTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

3D structure

• PDB: 6uaj Cryo-EM structures demonstrate human IMPDH2 filament assembly tunes allosteric regulation.
• Chain: F
• Resolution: 3.84 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.205: IMP dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	F	Y110 Q112 I115 P118 F139 C140 G141 S160 T225	Y101 Q103 I106 P109 F130 C131 G132 S151 T216
BS02	GTP	F	L194 N198 D226 N230 K238 K242	L185 N189 D217 N221 K229 K233
BS03	ATP	F	S159 S160 R161 L185 V186 K206 G207 K208	S150 S151 R152 L176 V177 K197 G198 K199
BS04	IMP	F	M70 I330 C331 D364 G365 S388 G413 M414 G415	M61 I321 C322 D355 G356 S379 G404 M405 G406
BS05	NAD	F	T252 H253 D274 S275 S276 F282 N303 M414	T243 H244 D265 S266 S267 F273 N294 M405

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0003824 catalytic activity
• GO:0003938 IMP dehydrogenase activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0006177 GMP biosynthetic process
• GO:0006183 GTP biosynthetic process
• GO:0007623 circadian rhythm
• GO:0046651 lymphocyte proliferation
• GO:0071353 cellular response to interleukin-4
• GO:0097294 'de novo' XMP biosynthetic process

Cellular Component

• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005778 peroxisomal membrane
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0034774 secretory granule lumen
• GO:0070062 extracellular exosome
• GO:1904813 ficolin-1-rich granule lumen

External links

• PDB: RCSB:6uaj, PDBe:6uaj, PDBj:6uaj
• PDBsum: 6uaj
• PubMed: 31999252
• UniProt: P12268|IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 (Gene Name=IMPDH2)