Structure of PDB 6tsy Chain F

Receptor sequence
>6tsyF (length=86) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
ADLANGAKVFSGNCAACHMGGGNVVMANKTLKKEALEQFGMYSEDAIIYQ
VQHGKNAMPAFAGRLTDEQIQDVAAYVLDQAAKGWA
3D structure
PDB6tsy Crystal structures of native cytochrome c6from Thermosynechococcus elongatus in two different space groups and implications for its oligomerization.
ChainF
Resolution2.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC F N38 C39 C42 H43 N48 M51 K54 T55 L56 L61 F64 Q75 N81 M83 F86 N13 C14 C17 H18 N23 M26 K29 T30 L31 L36 F39 Q50 N56 M58 F61
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009579 thylakoid
GO:0031977 thylakoid lumen
GO:0031979 plasma membrane-derived thylakoid lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tsy, PDBe:6tsy, PDBj:6tsy
PDBsum6tsy
PubMed32880593
UniProtP0A3X9|CYC6_THEVB Cytochrome c6 (Gene Name=petJ)

[Back to BioLiP]