Structure of PDB 6trc Chain F

Receptor sequence
>6trcF (length=141) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
DVAGLVPCKDSPAFQKRAAAAVNTTADPASGQKRFERYSQALCGEDGLPH
LVVDGRLSRAGDFLIPSVLFLYIAGWIGWVGRAYLIAVRNSGEANEKEII
IDVPLAIKCMLTGFAWPLAALKELASGELTAKDNEITVSPR
3D structure
PDB6trc Current limits of structural biology: The transient interaction between cytochrome c6 and photosystem I
ChainF
Resolution2.98 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F D54 R56 D54 R56
BS02 CLA F G78 G81 G78 G81
BS03 CLA F S67 F70 A74 S67 F70 A74
BS04 CLA F V53 F63 S67 V53 F63 S67
BS05 CLA F L85 E98 M110 L85 E98 M110
BS06 CLA F W76 I77 M110 W76 I77 M110
BS07 CLA F L69 F114 A115 L118 L69 F114 A115 L118
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6trc, PDBe:6trc, PDBj:6trc
PDBsum6trc
PubMed
UniProtP0A401|PSAF_THEVB Photosystem I reaction center subunit III (Gene Name=psaF)

[Back to BioLiP]