Structure of PDB 6t7d Chain F |
>6t7dF (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] |
KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENV IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
|
PDB | 6t7d Nucleosome-bound SOX2 and SOX11 structures elucidate pioneer factor function. |
Chain | F |
Resolution | 4.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
F |
R45 I46 R78 K79 |
R30 I31 R63 K64 |
|
|
|
|