Structure of PDB 6swa Chain F

Receptor sequence

>6swaF (length=234) Species: 10090 (Mus musculus)

PETLKKKRRNFAELKVKRLRKKFALKTLRKARRKLIYEKAKHYHKEYRQM
YRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRL
RQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINK
KRIALTDNSLIARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLS
SPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN

3D structure

• PDB: 6swa Protein Synthesis in the Developing Neocortex at Near-Atomic Resolution Reveals Ebp1-Mediated Neuronal Proteostasis at the 60S Tunnel Exit.
• Chain: F
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	R43 R47 K48 Y51 H58 R62 Y65 I69 R70 M71 R73 M74 R76 K77 R96 G97 N99 P103 K104 K107 L111 R113 Q116 I117 K127 A128 N131 M132 N146 L147 N151 K156 K164 K165 R166 K181 E188 K202 N206 K212 L213 S214 S215 P216 R217 G219 M220 K221 K222 K223 R242 R245	R29 R33 K34 Y37 H44 R48 Y51 I55 R56 M57 R59 M60 R62 K63 R82 G83 N85 P89 K90 K93 L97 R99 Q102 I103 K113 A114 N117 M118 N132 L133 N137 K142 K150 K151 R152 K167 E174 K188 N192 K198 L199 S200 S201 P202 R203 G205 M206 K207 K208 K209 R228 R231
BS02	rna	F	R134 K222 E229	R120 K208 E215

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

External links

• PDB: RCSB:6swa, PDBe:6swa, PDBj:6swa
• PDBsum: 6swa
• PubMed: 33357414
• UniProt: P14148|RL7_MOUSE Large ribosomal subunit protein uL30 (Gene Name=Rpl7)