Structure of PDB 6sv1 Chain F |
>6sv1F (length=90) Species: 1085 (Rhodospirillum rubrum) [Search protein sequence] |
THEPLEVLKEETVNRHRAIVSVMEELAAVDWYDQRVDASTDPELTAILAH NRDEEKEHAAMTLEWLRRNDAKWAEHLRTYLFTEGPITAA |
|
PDB | 6sv1 Dissecting the structural and functional roles of a putative metal entry site in encapsulated ferritins. |
Chain | F |
Resolution | 2.19 Å |
3D structure |
|
|
Enzyme Commision number |
1.16.3.1: ferroxidase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
F |
E32 E62 H65 |
E25 E55 H58 |
|
|
|
|