Structure of PDB 6rn6 Chain F

Receptor sequence

>6rn6F (length=67) Species: 9606 (Homo sapiens)

PFNPFELTNHAVLLVGYGTDSAGMDYWIVKNSWGTGWGENGYFRIRRGTD
ECAIESIAVAATPIPKL

3D structure

• PDB: 6rn6 DPP1 Inhibitors: Exploring the Role of Water in the S2 Pocket of DPP1 with Substituted Pyrrolidines.
• Chain: F
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H381 N403
• Catalytic site (residue number reindexed from 1): H10 N31
• Enzyme Commision number: 3.4.14.1: dipeptidyl-peptidase I.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	K9Q	F	T379 N380 H381	T8 N9 H10	PDBbind-CN: -logKd/Ki=6.80,IC50=158nM

Gene Ontology

Molecular Function

• GO:0008234 cysteine-type peptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:6rn6, PDBe:6rn6, PDBj:6rn6
• PDBsum: 6rn6
• PubMed: 31413809
• UniProt: P53634|CATC_HUMAN Dipeptidyl peptidase 1 (Gene Name=CTSC)