Structure of PDB 6r5k Chain F

Receptor sequence
>6r5kF (length=165) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAY
VNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNL
HPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAI
DALNGMLLNGQEIYV
3D structure
PDB6r5k Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
ChainF
Resolution4.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna F Y41 D44 S66 R68 C70 L79 G80 Y81 Y83 N85 W113 S114 Q115 R116 D117 P118 K123 G124 G126 N127 I128 F129 K131 S154 F170 E176 V198 Y8 D11 S33 R35 C37 L46 G47 Y48 Y50 N52 W80 S81 Q82 R83 D84 P85 K90 G91 G93 N94 I95 F96 K98 S121 F137 E143 V165
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003730 mRNA 3'-UTR binding
GO:0005515 protein binding
GO:0008143 poly(A) binding
GO:0008266 poly(U) RNA binding
GO:0008428 ribonuclease inhibitor activity
GO:0140693 molecular condensate scaffold activity
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0006397 mRNA processing
GO:0006417 regulation of translation
GO:0006446 regulation of translational initiation
GO:0031124 mRNA 3'-end processing
GO:0051028 mRNA transport
GO:0060211 regulation of nuclear-transcribed mRNA poly(A) tail shortening
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0010494 cytoplasmic stress granule
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6r5k, PDBe:6r5k, PDBj:6r5k
PDBsum6r5k
PubMed31104843
UniProtP04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear (Gene Name=PAB1)

[Back to BioLiP]