Structure of PDB 6q8y Chain F

Receptor sequence

>6q8yF (length=141) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPL
LLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR

3D structure

PDB

6q8y Structure of the 80S ribosome-Xrn1 nuclease complex.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	Q8 F10 K12 K13 K14 S15 T17 H21 K30 R66 T70 G71 G72 G73 S76 Q77 I118 R122 R123 P124 E125 P126 K127 K128 F129 K132 G133 R135 S136 F138 Q139 K140 S141 Y142 R143	Q6 F8 K10 K11 K12 S13 T15 H19 K28 R64 T68 G69 G70 G71 S74 Q75 I116 R120 R121 P122 E123 P124 K125 K126 F127 K130 G131 R133 S134 F136 Q137 K138 S139 Y140 R141

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation
GO:0006413	translational initiation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6q8y, PDBe:6q8y, PDBj:6q8y
PDBsum	6q8y
PubMed	30911188
UniProt	P0CX51\|RS16A_YEAST Small ribosomal subunit protein uS9A (Gene Name=RPS16A)