Structure of PDB 6ppv Chain F

Receptor sequence
>6ppvF (length=71) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
SSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGK
KTNVYGDAFIRGNNVLYVSAL
3D structure
PDB6ppv Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
ChainF
Resolution2.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F R63 N65 R61 N63
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008266 poly(U) RNA binding
GO:0030620 U2 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006364 rRNA processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
GO:1905323 telomerase holoenzyme complex assembly
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005686 U2 snRNP
GO:0005688 U6 snRNP
GO:0005697 telomerase holoenzyme complex
GO:0005730 nucleolus
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
GO:0005737 cytoplasm
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0120114 Sm-like protein family complex
GO:0120115 Lsm2-8 complex
GO:1990726 Lsm1-7-Pat1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppv, PDBe:6ppv, PDBj:6ppv
PDBsum6ppv
PubMed32518066
UniProtQ9UUI1|LSM6_SCHPO U6 snRNA-associated Sm-like protein LSm6 (Gene Name=lsm6)

[Back to BioLiP]