Structure of PDB 6ppk Chain F

Receptor sequence
>6ppkF (length=139) Species: 1423 (Bacillus subtilis) [Search protein sequence]
NRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVSAVEELTFIAG
QKPVVTRAKGMPIGAKVTLRGERMYDFLDKLISVSLPRVRDFRGVSKKSF
DGRGNYTLGIVRGMDIVIVTTANTDEEARELLTQVGMPF
3D structure
PDB6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
ChainF
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F K33 V35 N37 M38 G39 V40 T68 I85 K88 D123 T129 G151 D153 K32 V34 N36 M37 G38 V39 T56 I63 K66 D101 T107 G113 D115
BS02 rna F K5 D23 S24 M26 Q27 Q63 K64 V66 T90 R92 K4 D22 S23 M25 Q26 Q51 K52 V54 T68 R70
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
PDBsum6ppk
PubMed31665744
UniProtP12877|RL5_BACSU Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]