Structure of PDB 6oif Chain F

Receptor sequence
>6oifF (length=282) Species: 9606 (Homo sapiens) [Search protein sequence]
GQKRSLSREALQKDLDDNLFGQHLAKKIILNAVFGFINNPKPKKPLTLSL
HGWTGTGKNFVSKIIAENIYEGGLNSDYVHLFVATLHFPHASNITLYKDQ
LQLWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQK
AMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNS
GFWHSSLIDRNLIDYFVPFLPLEYKHLKMCIRVEMQSRGYEIDEDIVSRV
AEEMTFFPKEERVFSDKGCKTVFTKLDYYYDD
3D structure
PDB6oif The AAA + ATPase TorsinA polymerizes into hollow helical tubes with 8.5 subunits per turn.
ChainF
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP F K93 Y189 K43 Y139
BS02 ATP F F70 T104 G105 T106 G107 K108 N109 F110 L272 C319 K320 F20 T54 G55 T56 G57 K58 N59 F60 L222 C269 K270
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008092 cytoskeletal protein binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0019894 kinesin binding
GO:0042802 identical protein binding
GO:0051082 unfolded protein binding
GO:0051787 misfolded protein binding
GO:0140662 ATP-dependent protein folding chaperone
Biological Process
GO:0000338 protein deneddylation
GO:0006979 response to oxidative stress
GO:0006996 organelle organization
GO:0006998 nuclear envelope organization
GO:0007155 cell adhesion
GO:0031175 neuron projection development
GO:0034504 protein localization to nucleus
GO:0036503 ERAD pathway
GO:0044319 wound healing, spreading of cells
GO:0045104 intermediate filament cytoskeleton organization
GO:0048489 synaptic vesicle transport
GO:0048499 synaptic vesicle membrane organization
GO:0051085 chaperone cofactor-dependent protein refolding
GO:0051584 regulation of dopamine uptake involved in synaptic transmission
GO:0061077 chaperone-mediated protein folding
GO:0071763 nuclear membrane organization
GO:1900244 positive regulation of synaptic vesicle endocytosis
GO:2000008 regulation of protein localization to cell surface
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005788 endoplasmic reticulum lumen
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0008021 synaptic vesicle
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0030141 secretory granule
GO:0030426 growth cone
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0031965 nuclear membrane
GO:0042995 cell projection
GO:0043231 intracellular membrane-bounded organelle
GO:0045202 synapse
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6oif, PDBe:6oif, PDBj:6oif
PDBsum6oif
PubMed31332180
UniProtO14656|TOR1A_HUMAN Torsin-1A (Gene Name=TOR1A)

[Back to BioLiP]