Structure of PDB 6oa9 Chain F

Receptor sequence
>6oa9F (length=533) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
NEVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPG
TGKTLMARAVANETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAP
AIIFIDEIDSIAPKRDKTNGEVERRVVSQLLTLMDGMKARSNVVVIAATN
RPNSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMKLADDVDLEA
LAAETHGYVGADIASLCSEAAMQQIREKMDDSLGVTMDNFRFALGNSNPS
ALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSK
GVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDI
FDKARAAAPTVVFLDQLDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMN
AKKNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDENARLSILNAQLR
KTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAIKDSIEAHITKEHF
AEAMKTAKRSVSDAELRRYEAYSQQMKASRGQF
3D structure
PDB6oa9 Substrate processing by the Cdc48 ATPase complex is initiated by ubiquitin unfolding.
ChainF
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.6: vesicle-fusing ATPase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ATP F I216 G258 T259 G260 L263 H394 G418 A419 I8 G50 T51 G52 L55 H186 G210 A211
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0019888 protein phosphatase regulator activity
GO:0031593 polyubiquitin modification-dependent protein binding
GO:0042802 identical protein binding
GO:0043130 ubiquitin binding
Biological Process
GO:0006274 DNA replication termination
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
GO:0010636 positive regulation of mitochondrial fusion
GO:0015031 protein transport
GO:0016236 macroautophagy
GO:0016320 endoplasmic reticulum membrane fusion
GO:0030970 retrograde protein transport, ER to cytosol
GO:0031134 sister chromatid biorientation
GO:0032984 protein-containing complex disassembly
GO:0034517 ribophagy
GO:0034727 piecemeal microautophagy of the nucleus
GO:0036503 ERAD pathway
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046034 ATP metabolic process
GO:0051228 mitotic spindle disassembly
GO:0070651 nonfunctional rRNA decay
GO:0071629 cytoplasm protein quality control by the ubiquitin-proteasome system
GO:0071630 nuclear protein quality control by the ubiquitin-proteasome system
GO:0072344 rescue of stalled ribosome
GO:0072671 mitochondria-associated ubiquitin-dependent protein catabolic process
GO:0097352 autophagosome maturation
GO:0099638 endosome to plasma membrane protein transport
GO:0120174 stress-induced homeostatically regulated protein degradation pathway
GO:1900182 positive regulation of protein localization to nucleus
GO:1902979 mitotic DNA replication termination
GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process
GO:1990171 SCF complex disassembly in response to cadmium stress
Cellular Component
GO:0000837 Doa10p ubiquitin ligase complex
GO:0000839 Hrd1p ubiquitin ligase ERAD-L complex
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0030894 replisome
GO:0034098 VCP-NPL4-UFD1 AAA ATPase complex
GO:0036266 Cdc48p-Npl4p-Vms1p AAA ATPase complex
GO:0043332 mating projection tip
GO:1990112 RQC complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6oa9, PDBe:6oa9, PDBj:6oa9
PDBsum6oa9
PubMed31249135
UniProtP25694|CDC48_YEAST Cell division control protein 48 (Gene Name=CDC48)

[Back to BioLiP]