Structure of PDB 6nu2 Chain F

Receptor sequence

>6nu2F (length=250) Species: 9606 (Homo sapiens)

EPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLD
ILHQVAMWQKNFKRISYAKTKTRAEVRGGGRKPWPQKGTGRARHGSIRSP
LWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLAQDDLHIMDSLE
LPTGDPQYLTELAHYRRWGDSVLLVDLTHEEMPQSIVEATSRLKTFNLIP
AVGLNVHSMLKHQTLVLTLPTVAFLEDKLLWQDSRYRPLYPFSLPYSDFP

3D structure

• PDB: 6nu2 Structural insights into unique features of the human mitochondrial ribosome recycling.
• Chain: F
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	R92 I95 H97 M101 K104 N105 R108 Y111 T114 T116 R117 R121 G122 G124 R125 K126 Q130 K131 G134 R135 R137 H138 G139 R142 L145 R147 G148 H153 P155 Y163 M164 L165 P166 M167 K168 R170 L172 K255 R281 P282 L283 Y284 P285	R48 I51 H53 M57 K60 N61 R64 Y67 T70 T72 R73 R77 G78 G80 R81 K82 Q86 K87 G90 R91 R93 H94 G95 R98 L101 R103 G104 H109 P111 Y119 M120 L121 P122 M123 K124 R126 L128 K211 R237 P238 L239 Y240 P241
BS02	MG	F	G148 G149	G104 G105

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6nu2, PDBe:6nu2, PDBj:6nu2
• PDBsum: 6nu2
• PubMed: 30962385
• UniProt: Q9BYD3|RM04_HUMAN Large ribosomal subunit protein uL4m (Gene Name=MRPL4)