Structure of PDB 6nn6 Chain F |
>6nn6F (length=78) Species: 8355 (Xenopus laevis) [Search protein sequence] |
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE HAKRKTVTAMDVVYALKRQGRTLYGFGG |
|
PDB | 6nn6 Structural Basis for Recognition of Ubiquitylated Nucleosome by Dot1L Methyltransferase. |
Chain | F |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
F |
R45 I46 S47 T80 |
R21 I22 S23 T56 |
|
|
|
|