Structure of PDB 6n97 Chain F

Receptor sequence

>6n97F (length=260) Species: 83333 (Escherichia coli K-12)

AYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCI
ILRAPSGSKVFSAGHDIHELPSGGRDPLSYDDPLRQITRMIQKFPKPIIS
MVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRD
AGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEK
APLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRAVYDSEDYQEGMNAFL
EKRKPNFVGH

3D structure

• PDB: 6n97 Sulfonate/Nitro Bearing Methylmalonyl-Thioester Isosteres Applied to Methylmalonyl-CoA Decarboxylase Structure-Function Studies.
• Chain: F
• Resolution: 1.75 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H66 L71 G110 E113 P133 V138 Y140 E228 Y238
• Catalytic site (residue number reindexed from 1): H65 L70 G109 E112 P132 V137 Y139 E227 Y237
• Enzyme Commision number: 4.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	YZS	F	A64 H66 D67 I68 W108 G109 G110 T132 P133 Y140 F250 K253	A63 H65 D66 I67 W107 G108 G109 T131 P132 Y139 F249 K252	MOAD: Ki=7.1uM
BS02	KGP	F	A64 H66 D67 I68 W108 G109 G110 T132 P133 Y140 F250 K253	A63 H65 D66 I67 W107 G108 G109 T131 P132 Y139 F249 K252	MOAD: Ki=7.1uM
BS03	YZS	F	S106 W108 T128 F129 S130 S165 P166	S105 W107 T127 F128 S129 S164 P165	MOAD: Ki=7.1uM

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004492 methyl/ethyl malonyl-CoA decarboxylase activity
• GO:0016829 lyase activity
• GO:0016831 carboxy-lyase activity

Biological Process

• GO:0006635 fatty acid beta-oxidation

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6n97, PDBe:6n97, PDBj:6n97
• PDBsum: 6n97
• PubMed: 30869886
• UniProt: P52045|SCPB_ECOLI Methylmalonyl-CoA decarboxylase (Gene Name=scpB)