Structure of PDB 6mdo Chain F

Receptor sequence
>6mdoF (length=241) Species: 10029 (Cricetulus griseus) [Search protein sequence]
DYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHS
GKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQL
SCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTS
RKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQ
VKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGA
3D structure
PDB6mdo Structural principles of SNARE complex recognition by the AAA+ protein NSF.
ChainF
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.6: vesicle-fusing ATPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP F N505 I507 S547 G548 T550 D604 I707 K708 N8 I10 S50 G51 T53 D107 I210 K211
Gene Ontology
Molecular Function
GO:0000149 SNARE binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0017075 syntaxin-1 binding
GO:0019901 protein kinase binding
GO:0019905 syntaxin binding
GO:0030165 PDZ domain binding
GO:0035255 ionotropic glutamate receptor binding
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
GO:0140545 ATP-dependent protein disaggregase activity
Biological Process
GO:0001921 positive regulation of receptor recycling
GO:0006813 potassium ion transport
GO:0006886 intracellular protein transport
GO:0006891 intra-Golgi vesicle-mediated transport
GO:0015031 protein transport
GO:0035494 SNARE complex disassembly
GO:0043001 Golgi to plasma membrane protein transport
GO:0045732 positive regulation of protein catabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005795 Golgi stack
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0030496 midbody

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6mdo, PDBe:6mdo, PDBj:6mdo
PDBsum6mdo
PubMed30198481
UniProtP18708|NSF_CRIGR Vesicle-fusing ATPase (Gene Name=NSF)

[Back to BioLiP]