Structure of PDB 6m8r Chain F |
>6m8rF (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] |
FPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPKDLAKDSKGRFFIDR DGFLFRYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLT |
|
PDB | 6m8r Structural basis for KCTD-mediated rapid desensitization of GABABsignalling. |
Chain | F |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
F |
D87 D91 Q93 |
D60 D64 Q66 |
|
|
|
|