Structure of PDB 6lb3 Chain F |
>6lb3F (length=93) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
MRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADM AIRLGRYFDTSAQFWMNLQSEYSLATAYAANGKQIEHEIEPLL |
|
PDB | 6lb3 Crystal structure of PA4674 in complex with its operator DNA (18bp) from Pseudomonas aeruginosa |
Chain | F |
Resolution | 2.497 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
F |
R49 G50 S52 |
R44 G45 S47 |
|
|
|
|