Structure of PDB 6koq Chain F

Receptor sequence
>6koqF (length=148) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
TDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFR
SFRHGTNLKAWLYRILTNTYINSRSAEVEALEALPDTEIKEALQALPEEF
RMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVAR
3D structure
PDB6koq RNA extension drives a stepwise displacement of an initiation-factor structural module in initial transcription.
ChainF
Resolution3.353 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F L45 R46 K64 R73 N77 A80 W81 R84 L25 R26 K44 R53 N57 A60 W61 R64
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0006979 response to oxidative stress
GO:0009408 response to heat
GO:0034605 cellular response to heat
GO:0051409 response to nitrosative stress
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6koq, PDBe:6koq, PDBj:6koq
PDBsum6koq
PubMed32127479
UniProtP9WGH9|SIGH_MYCTU ECF RNA polymerase sigma factor SigH (Gene Name=sigH)

[Back to BioLiP]