Structure of PDB 6kiz Chain F |
>6kizF (length=78) Species: 8355 (Xenopus laevis) [Search protein sequence] |
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT EHAKRKTVTAMDVVYALKRQGRTLYGFG |
|
PDB | 6kiz Structural basis of nucleosome recognition and modification by MLL methyltransferases. |
Chain | F |
Resolution | 4.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
F |
R45 R78 |
R22 R55 |
|
|
|
|