Structure of PDB 6k0b Chain F

Receptor sequence
>6k0bF (length=95) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence]
MITPHNILRHELIGLKVEIVEAKNKAMIGIKGKVVDETRNTLVIEKEDGR
EVVIPKDIAVFLFQLKGCKVKVDGRLLIGRPEERLKKKIKILYPY
3D structure
PDB6k0b Cryo-electron microscopy structure of an archaeal ribonuclease P holoenzyme.
ChainF
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F K86 K87 K88 K86 K87 K88
BS02 rna F K23 T38 R39 N40 T41 R80 K23 T38 R39 N40 T41 R80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004526 ribonuclease P activity
GO:0033204 ribonuclease P RNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006396 RNA processing
GO:0008033 tRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005737 cytoplasm
GO:0030677 ribonuclease P complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6k0b, PDBe:6k0b, PDBj:6k0b
PDBsum6k0b
PubMed31197137
UniProtQ57903|RNP1_METJA Ribonuclease P protein component 1 (Gene Name=rnp1)

[Back to BioLiP]