Structure of PDB 6hqu Chain F

Receptor sequence
>6hquF (length=204) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
ATIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQL
PPEEGGLNGSAMYIDTENTFRPERLREIAQNRGLDPDEVLDNVAYARAQM
QLLYQASAMMVESLNTDRPYKLLIVDSLTRQQKLARFLRMLHRLANEFDI
AVFVTNQVQANGGHILAHSATLRVYLRKGKGGKRIARLIDGEAVFSITEK
GIED
3D structure
PDB6hqu Improved RAD51 binders through motif shuffling based on the modularity of BRC repeats.
ChainF
Resolution1.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide F L197 V200 A201 Y202 A203 A220 M221 E224 Y232 L90 V93 A94 Y95 A96 A108 M109 E112 Y120
BS02 ADP F G141 S142 G143 K144 T145 Q146 R181 R323 I342 G34 S35 G36 K37 T38 Q39 R74 R184 I197
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Thu Nov 28 05:31:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6hqu', asym_id = 'F', title = 'Improved RAD51 binders through motif shuffling based on the modularity of BRC repeats.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6hqu', asym_id='F', title='Improved RAD51 binders through motif shuffling based on the modularity of BRC repeats.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003677,0003684,0005524,0006259,0006281,0006310,0008094,0016887,0140664', uniprot = '', pdbid = '6hqu', asym_id = 'F'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003684,0005524,0006259,0006281,0006310,0008094,0016887,0140664', uniprot='', pdbid='6hqu', asym_id='F')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>