Structure of PDB 6ha8 Chain F

Receptor sequence

>6ha8F (length=176) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

NRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAID
SAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLD
KLISVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRG
MDIVIVTTANTDEEARELLTQVGMPF

3D structure

• PDB: 6ha8 Structural basis for antibiotic resistance mediated by theBacillus subtilisABCF ATPase VmlR.
• Chain: F
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	K33 N37 G41 T68 K71 K72 F77 I85 K88 S121 D123 N127 T129 G131 I132 K133 R150 G151 D153	K32 N36 G40 T67 K70 K71 F76 I84 K87 S120 D122 N126 T128 G130 I131 K132 R149 G150 D152
BS02	rna	F	S24 V25 M26 Q27 K30 Q63 K64 V66 K88 T90 R92	S23 V24 M25 Q26 K29 Q62 K63 V65 K87 T89 R91

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ha8, PDBe:6ha8, PDBj:6ha8
• PDBsum: 6ha8
• PubMed: 30126986
• UniProt: P12877|RL5_BACSU Large ribosomal subunit protein uL5 (Gene Name=rplE)