Structure of PDB 6gq1 Chain F

Receptor sequence

>6gq1F (length=222) Species: 559292 (Saccharomyces cerevisiae S288C)

AEQVAAERAARKAANKEKRAIILERNAAYQKEYETAERNIIQAKRDAKAA
GSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVTKA
TLELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEAN
LGKYGILSIDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKH
FIQGGSFGNREEFINKLVKSMN

3D structure

• PDB: 6gq1 Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
• Chain: F
• Resolution: 4.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	R30 R33 N37 R41 I63 R67 K70 K90 G91 I92 K94 P97 K98 V102 L105 R107 R110 I111 K121 E125 S142 R145 K158 Q159 R160 K196 K206 S208 N209 P210 S211 P217 R218 K219 K238 K241	R8 R11 N15 R19 I41 R45 K48 K68 G69 I70 K72 P75 K76 V80 L83 R85 R88 I89 K99 E103 S120 R123 K136 Q137 R138 K174 K184 S186 N187 P188 S189 P195 R196 K197 K216 K219
BS02	rna	F	K128 R218 F220 H222 I224	K106 R196 F198 H200 I202

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gq1, PDBe:6gq1, PDBj:6gq1
• PDBsum: 6gq1
• PubMed: 29886014
• UniProt: P05737|RL7A_YEAST Large ribosomal subunit protein uL30A (Gene Name=RPL7A)