Structure of PDB 6g0y Chain F

Receptor sequence
>6g0yF (length=171) Species: 11259 (Human respiratory syncytial virus A2) [Search protein sequence]
RNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKS
IDTLSEISGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLL
TELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLP
ADVLKKTIKNTLDIHKSITIN
3D structure
PDB6g0y The Structure of the Human Respiratory Syncytial Virus M2-1 Protein Bound to the Interaction Domain of the Phosphoprotein P Defines the Orientation of the Complex.
ChainF
Resolution2.42 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F R126 V127 Y134 S137 Q144 T145 L148 L152 T160 N163 R123 V124 Y131 S134 Q141 T142 L145 L149 T157 N160
BS02 ZN F C7 C15 C21 H25 C4 C12 C18 H22
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005198 structural molecule activity
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0019083 viral transcription
GO:0031564 transcription antitermination
GO:0046782 regulation of viral transcription
GO:0085033 symbiont-mediated activation of host NF-kappaB cascade
Cellular Component
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6g0y, PDBe:6g0y, PDBj:6g0y
PDBsum6g0y
PubMed30425144
UniProtP04545|M21_HRSVA Protein M2-1 (Gene Name=M2-1)

[Back to BioLiP]