Structure of PDB 6fyx Chain F

Receptor sequence

>6fyxF (length=206) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

FVPVELATTIPVEIQQAQQEIKLFNKWSFEDVEVKDASLVDYIQISKPIY
VAHTAGRYANKRFRKAQCPIVERLTNSLMMNGRNNGKKLKAVRIVKHTLE
IINVLTDQNPLQVVVDAIINSGPREDTTRVGGGGAARRQAVDVSPLRRVN
QSIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELER
VAKSNR

3D structure

• PDB: 6fyx Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
• Chain: F
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	H74 A80 N81 K82 R83 K86 N97 L99 M100 M101 N102 G103 R104 N105 N106 G107 K108 K109 K111 R114 I115 N171 R182 F186 R187 N188 I189 T191 I192	H53 A59 N60 K61 R62 K65 N76 L78 M79 M80 N81 G82 R83 N84 N85 G86 K87 K88 K90 R93 I94 N150 R161 F165 R166 N167 I168 T170 I171
BS02	rna	F	G153 G154 G155	G132 G133 G134

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6fyx, PDBe:6fyx, PDBj:6fyx
• PDBsum: 6fyx
• PubMed: 30475211
• UniProt: Q6CRA3